PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019257m
Common NameCICLE_v10019257mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 643aa    MW: 71290.1 Da    PI: 6.5603
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019257mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B382.44.2e-2677178199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f k+ltpsd++++g +++pk++a+e+      +++++  ++l+ +d++g +W++++iyr++++r++lt+GW+ Fv +++L +gD+++F +    
  Ciclev10019257m  77 FSKKLTPSDTSTHGGFSVPKRHADEClppldmSKDPPL-QELVAKDLHGLEWRFRHIYRGQPKRHLLTSGWSVFVTSKKLVAGDVCIFLR--GG 167
                      88*****************************7445545.59************************************************3..47 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+v+v+r+
  Ciclev10019257m 168 DGELRVGVRRA 178
                      9999****996 PP

2Auxin_resp99.64.4e-33203285183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a ha+st++ F+v+Y+P++ ++eF v++++++k+ ++ +s+G+Rf+m fe+e+++ +r++Gtvvg++d+d +rWp S+Wr+Lk
  Ciclev10019257m 203 AFHAISTGTRFTVYYHPWTRPAEFLVPFSQYMKSAEIDYSIGTRFRMVFEGEECADQRIAGTVVGTEDVDHIRWPASEWRCLK 285
                      689******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-3570196IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-4073191IPR015300DNA-binding pseudobarrel domain
CDDcd100173.32E-2476177No hitNo description
PROSITE profilePS5086312.88777179IPR003340B3 DNA binding domain
SMARTSM010191.9E-2577179IPR003340B3 DNA binding domain
PfamPF023621.4E-2377178IPR003340B3 DNA binding domain
PfamPF065071.6E-30203285IPR010525Auxin response factor
PROSITE profilePS5174520.535543625IPR000270PB1 domain
SuperFamilySSF542773.53E-10547620No hitNo description
PfamPF023092.2E-7584631IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MEQVEAYNSQ DDKAELPIYN LPPKILCEVV YAQLKAEPGT DEVFAQITLL PRPEIDELSL  60
EVGNSPPLPP KLNVCSFSKK LTPSDTSTHG GFSVPKRHAD ECLPPLDMSK DPPLQELVAK  120
DLHGLEWRFR HIYRGQPKRH LLTSGWSVFV TSKKLVAGDV CIFLRGGDGE LRVGVRRAMK  180
LQNNASTSVI SSLSMQHGIL AGAFHAISTG TRFTVYYHPW TRPAEFLVPF SQYMKSAEID  240
YSIGTRFRMV FEGEECADQR IAGTVVGTED VDHIRWPASE WRCLKVKWDA TTDSITRPAR  300
VSPWNIEPIE RTHKRPASVQ HQQKRLRPND ASSPWFSSLF RVFQGQENRV TGVKALGAAK  360
TPLLPSLVRP PNPVWAQMQS GLENKLKFPM HDPFYMCLNR MVSLPGGSLM SPGLSNHWPA  420
SPFAPYEVCE TAAQSKNLSV PNASSENSGS QMCMALELKD ENRTPLAQPN GGSRYMLFGV  480
NLVNSPPELP SPQMATSNEL ESPCSVPPTS QSSISETIQV SEPSKSVSGI LSEKQCKNCY  540
VSRSCTKVIK FGTALGRSVD LTRFHGYDEL ISELDQMFDF NGSLIDGNSG FHIAYMDDEG  600
DMMLVGDNPW QDFQCAVRRM FICPKEDIDG VIPSSPNPTP PQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-118130949355Auxin response factor 1
4ldw_A1e-118130949355Auxin response factor 1
4ldw_B1e-118130949355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.229930.0fruit
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444215.10.0hypothetical protein CICLE_v10019257mg
TrEMBLV4U0890.0V4U089_9R
STRINGVIT_07s0104g01230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157971016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.41e-143auxin response factor 1